PDB entry 2quh

View 2quh on RCSB PDB site
Description: Crystal structures of human tryptophanyl-tRNA synthetase in complex with Trp
Class: ligase
Keywords: Aminoacyl-tRNA synthetase, Rossmann fold, induced-fit mechnism, ATP-binding, Cytoplasm, Ligase, Nucleotide-binding, Protein biosynthesis
Deposited on 2007-08-05, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS, IFI53, WRS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381 (Start-470)
      • expression tag (471-474)
    Domains in SCOPe 2.07: d2quha2, d2quha3
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS, IFI53, WRS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381 (Start-470)
      • expression tag (471)
    Domains in SCOPe 2.07: d2quhb2, d2quhb3
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2quhA (A:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaysyavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2quhA (A:)
    gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
    ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
    enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
    kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
    stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
    dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
    vkefmtprklsfdfqhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2quhB (B:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaysyavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2quhB (B:)
    tssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldaye
    nkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqa
    ysyavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftd
    sdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypk
    pallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfg
    gncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrke
    vtdeivkefmtprklsfdfqh