PDB entry 2qug

View 2qug on RCSB PDB site
Description: Crystal structure of alpha-1-antitrypsin, crystal form A
Class: Protease Inhibitor
Keywords: antitrypsin, polymerisation, protein aggregation, protein unfolding, serpin, Acute phase, Disease mutation, Glycoprotein, Protease inhibitor, Secreted, Serine protease inhibitor
Deposited on 2007-08-05, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: HOMO SAPIENS
    Gene: SERPINA1, AAT, PI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2quga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qugA (A:)
    edpqgdaaqktdtshhdqdhptfnkitpnlaefafslyrqlahqsnstniffspvsiata
    famlslgtkadthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglfl
    seglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdt
    vfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvl
    lmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlk
    svlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsi
    ppevkfnkpfvflmieqntksplfmgkvvnptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qugA (A:)
    nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
    lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
    tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
    eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
    enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
    eaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntkspl
    fmgkvvnpt