PDB entry 2qu9

View 2qu9 on RCSB PDB site
Description: Crystal structure of the complex of group II phospholipase A2 with Eugenol
Class: Hydrolase
Keywords: pla2, eugenol, complex, Calcium, Hydrolase, Lipid degradation, Metal-binding, Neurotoxin, Presynaptic neurotoxin, Secreted, Toxin
Deposited on 2007-08-04, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qu9a_
  • Heterogens: SO4, EUG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qu9A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c