PDB entry 2qu4

View 2qu4 on RCSB PDB site
Description: Model for Bacterial ParM Filament
Class: structural protein
Keywords: filament model, actin-like protein, helical polymer, Plasmid, Plasmid partition, Structural protein
Deposited on 2007-08-03, released 2007-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 16 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmid segregation protein parM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qu4a1, d2qu4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qu4A (A:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign