PDB entry 2qtu

View 2qtu on RCSB PDB site
Description: Estrogen receptor beta ligand-binding domain complexed to a benzopyran ligand
Class: transcription regulator
Keywords: nuclear receptor, ligand-binding domain, Alternative splicing, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphorylation, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger, transcription regulator
Deposited on 2007-08-02, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.264
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtua_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtub_
  • Heterogens: 3AS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qtuA (A:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtuA (A:)
    dalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslfd
    qvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsr
    frelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqsm
    rlanllmllshvrhasnkgmehllnmkvydlllemlnah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qtuB (B:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtuB (B:)
    ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
    rfrelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkvydlllemlnahvl