PDB entry 2qto

View 2qto on RCSB PDB site
Description: An anisotropic model for potassium channel KcsA
Class: metal transport, membrane protein
Keywords: Potassium channel, membrane proteins, normal-mode refinement, anisotropic thermal factors, METAL TRANSPORT, MEMBRANE PROTEIN
Deposited on 2007-08-02, released 2007-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.272
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d2qtoa1
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d2qtob1
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d2qtoc1
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-96)
      • engineered (67)
    Domains in SCOPe 2.03: d2qtod1
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qtoA (A:)
    alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qtoB (B:)
    alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qtoC (C:)
    alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qtoD (D:)
    alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq