PDB entry 2qto
View 2qto on RCSB PDB site
Description: An anisotropic model for potassium channel KcsA
Class: metal transport, membrane protein
Keywords: Potassium channel, membrane proteins, normal-mode refinement, anisotropic thermal factors, METAL TRANSPORT, MEMBRANE PROTEIN
Deposited on
2007-08-02, released
2007-09-25
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.272
AEROSPACI score: 0.14
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA, skc1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2qtoa1 - Chain 'B':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA, skc1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2qtob1 - Chain 'C':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA, skc1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2qtoc1 - Chain 'D':
Compound: Voltage-gated potassium channel
Species: Streptomyces lividans [TaxId:1916]
Gene: kcsA, skc1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2qtod1 - Heterogens: K, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2qtoA (A:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2qtoB (B:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2qtoC (C:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2qtoD (D:)
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq