PDB entry 2qt6

View 2qt6 on RCSB PDB site
Description: Crystal Structure Determination of a Blue Laccase from Lentinus Tigrinus
Class: oxidoreductase
Keywords: Beta barrel, OXIDOREDUCTASE
Deposited on 2007-08-01, released 2007-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.15
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase
    Species: Lentinus tigrinus [TaxId:5365]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qt6a1, d2qt6a2, d2qt6a3
  • Chain 'B':
    Compound: laccase
    Species: Lentinus tigrinus [TaxId:5365]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qt6b1, d2qt6b2, d2qt6b3
  • Heterogens: CBS, NAG, MAN, CU, CA, CL, PER, TLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qt6A (A:)
    avgpvadltvtnanivpdgferaaivvnnvfpaplitgnmgdnfqlnlvnqmtnhtmlkt
    tsihwhgffqkgtnwadgpafinqcpiasgnsflydfqvpgqagtfwyhshlstqycdgl
    rgpfvvydpndphanlydvddestvitladwyhvaaklgprfpkgadstlinglgrstst
    ptadlavisvtkgkryrfrlvslscdpnytfsidshqltvieadgvstqpvtvdsiqifa
    aqrysfvlnanqdvdnywiranpnfgttgfadgvnsailryddadpvepvtnqtgttlll
    etdlhpltsmpvpgnptqggadlnlnmafnfdgtnffingesftpptvpvllqiisgant
    aqdllpsgsvyslpsnssieitfpattaapgaphpfhlhghvfavvrsagstsynyddpv
    wrdvvstgtpqagdnvtirfqtdnpgpwflhchidfhldagfavvmaedipntvnanpvp
    qawsnlcptydalepsne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qt6B (B:)
    avgpvadltvtnanivpdgferaaivvnnvfpaplitgnmgdnfqlnlvnqmtnhtmlkt
    tsihwhgffqkgtnwadgpafinqcpiasgnsflydfqvpgqagtfwyhshlstqycdgl
    rgpfvvydpndphanlydvddestvitladwyhvaaklgprfpkgadstlinglgrstst
    ptadlavisvtkgkryrfrlvslscdpnytfsidshqltvieadgvstqpvtvdsiqifa
    aqrysfvlnanqdvdnywiranpnfgttgfadgvnsailryddadpvepvtnqtgttlll
    etdlhpltsmpvpgnptqggadlnlnmafnfdgtnffingesftpptvpvllqiisgant
    aqdllpsgsvyslpsnssieitfpattaapgaphpfhlhghvfavvrsagstsynyddpv
    wrdvvstgtpqagdnvtirfqtdnpgpwflhchidfhldagfavvmaedipntvnanpvp
    qawsnlcptydalepsne