PDB entry 2qsp

View 2qsp on RCSB PDB site
Description: Bovine Hemoglobin at pH 5.7
Class: transport protein
Keywords: hemoglobin, Heme, Iron, Metal-binding, Oxygen transport, Transport, TRANSPORT PROTEIN
Deposited on 2007-07-31, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qspa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qspb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qspc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qspd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qspA (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qspB (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qspC (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qspD (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh