PDB entry 2qrz

View 2qrz on RCSB PDB site
Description: Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required
Class: cell cycle
Keywords: G-domain fold, G protein, GTPase, Alternative splicing, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, CELL CYCLE
Deposited on 2007-07-30, released 2008-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 42 homolog precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (0-188)
      • variant (162)
      • variant (181-186)
      • variant (188)
    Domains in SCOPe 2.01: d2qrza_
  • Chain 'B':
    Compound: Cell division control protein 42 homolog precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (0-188)
      • variant (162)
      • variant (182-186)
      • variant (188)
    Domains in SCOPe 2.01: d2qrzb_
  • Heterogens: MG, SO4, GCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qrzA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qrzB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrzB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk
    ksrrcv