PDB entry 2qrw

View 2qrw on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis trHbO WG8F mutant
Class: transport protein
Keywords: truncated hemoglobin fold, alpha helix, Heme, Hydroxylation, Iron, Membrane, Metal-binding, Oxygen transport, Transport, TRANSPORT PROTEIN
Deposited on 2007-07-30, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwa_
  • Chain 'B':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwb_
  • Chain 'C':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwc_
  • Chain 'D':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwd_
  • Chain 'E':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwe_
  • Chain 'F':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwf_
  • Chain 'G':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwg_
  • Chain 'H':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwh_
  • Chain 'I':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwi_
  • Chain 'J':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwj_
  • Chain 'K':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwk_
  • Chain 'L':
    Compound: Hemoglobin-like protein HbO
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glbO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A595 (Start-127)
      • engineered (87)
    Domains in SCOPe 2.07: d2qrwl_
  • Heterogens: CYN, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qrwA (A:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwA (A:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qrwB (B:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwB (B:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qrwC (C:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwC (C:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qrwD (D:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwD (D:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qrwE (E:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwE (E:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qrwF (F:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwF (F:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qrwG (G:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwG (G:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qrwH (H:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwH (H:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qrwI (I:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwI (I:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2qrwJ (J:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwJ (J:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2qrwK (K:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwK (K:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2qrwL (L:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrwL (L:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdaflrcmhtavasidsetlddehrrelldylemaahs
    lvnspf