PDB entry 2qrr

View 2qrr on RCSB PDB site
Description: Crystal structure of the soluble domain of the ABC transporter, ATP-binding protein from Vibrio parahaemolyticus
Class: hydrolase
Keywords: alpha-beta structure, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Amino-acid transport, ATP-binding, Hydrolase, Inner membrane, Membrane, Nucleotide-binding, Transport
Deposited on 2007-07-28, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine import ATP-binding protein metN
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: metN, VP0706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87RS1 (Start-100)
      • see remark 999 (89)
    Domains in SCOPe 2.07: d2qrra1
  • Chain 'B':
    Compound: Methionine import ATP-binding protein metN
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: metN, VP0706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87RS1 (3-100)
      • see remark 999 (89)
    Domains in SCOPe 2.07: d2qrrb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2qrrA (A:)
snalsipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldy
aggvkfgmmvaelfgneqddsaaieylrennvkvevlgyvl

    Sequence, based on observed residues (ATOM records): (download) 
    >2qrrA (A:)
sipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldyaggv
kfgmmvaelfgneqddsaaieylrennvkvevlgyvl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2qrrB (B:)
snalsipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldy
aggvkfgmmvaelfgneqddsaaieylrennvkvevlgyvl

    Sequence, based on observed residues (ATOM records): (download) 
    >2qrrB (B:)
lsipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldyagg
vkfgmmvaelfgneqddsaaieylrennvkvevlgyvl