PDB entry 2qrp

View 2qrp on RCSB PDB site
Description: Glycogen Phosphorylase b in complex with (1R)-3'-(2-naphthyl)-spiro[1,5-anhydro-D-glucitol-1,5'-isoxazoline]
Class: transferase
Keywords: glycogenolysis, type 2 diabetes, Acetylation, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphorylation, Pyridoxal phosphate, Transferase
Deposited on 2007-07-28, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qrpa_
  • Heterogens: S06, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qrpA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qrpA (A:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssk
    nfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeal
    erwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahl
    ciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiia
    erigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfd
    vqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklit
    aigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmln
    galtigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieq
    lssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirn
    iatsgkfssdrtiaqyareiwgvepsrqrlp