PDB entry 2qr9

View 2qr9 on RCSB PDB site
Description: Crystal Structure of the Estrogen Receptor Alpha Ligand Binding Domain Complexed with an Oxabicyclic Derivative Compound
Class: transcription
Keywords: Protein-Ligand Complex, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphorylation, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger
Deposited on 2007-07-27, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2qr9a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (240)
    Domains in SCOPe 2.07: d2qr9b_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HZ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qr9A (A:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr9A (A:)
    slalsltadqmvsalldaeppilyseyrpfseasmmglltnladrelvhminwakrvpgf
    vdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdm
    llatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtli
    hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldah
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qr9B (B:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    sdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr9B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    lh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.