PDB entry 2qr7

View 2qr7 on RCSB PDB site
Description: 2.0A X-ray structure of C-terminal kinase domain of p90 ribosomal S6 kinase 2: Se-Met derivative
Class: transferase
Keywords: kinase domain, RSK2, autoinhibitory, ATP-binding, Nucleotide-binding, Phosphorylation, Serine/threonine-protein kinase, Transferase
Deposited on 2007-07-27, released 2007-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-3
    Species: Mus musculus [TaxId:10090]
    Gene: Rps6ka3, Rps6ka-rs1, Rsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18654
      • engineered (192)
    Domains in SCOPe 2.06: d2qr7a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qr7A (A:)
    mqtvgvhsivqqlhrnsiqftdgyevkedigvgsysvckrcihkatnmefavkiidkskr
    dpteeieillrygqhpniitlkdvyddgkyvyvvtelmkggelldkilrqkffsereasa
    vlftitktveylhaqgvvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtp
    cytanfvapevlerqgydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkf
    slsggywnsvsdtakdlvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphl
    vkgamaatysalnrnqspvlepvgrstlaqrrgikkitstal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr7A (A:)
    qftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhpni
    itlkdvyddgkyvyvvtelmkggelldkilrqkffsereasavlftitktveylhaqgvv
    hrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqgyd
    aacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakdlv
    skmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnrnq