PDB entry 2qr0

View 2qr0 on RCSB PDB site
Description: Structure of VEGF complexed to a Fab containing TYR and SER in the CDRs
Class: immune system
Keywords: VEGF; Antibody Recognition; Specificity; Phage Display, IMMUNE SYSTEM
Deposited on 2007-07-27, released 2007-08-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.292
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0a1, d2qr0a2
  • Chain 'B':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0b1, d2qr0b2
  • Chain 'C':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0c1
  • Chain 'D':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0d1
  • Chain 'E':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0e1, d2qr0e2
  • Chain 'F':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0f1, d2qr0f2
  • Chain 'G':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0g1, d2qr0g2
  • Chain 'H':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0h1, d2qr0h2
  • Chain 'I':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0i1
  • Chain 'J':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0j1
  • Chain 'K':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0k1, d2qr0k2
  • Chain 'L':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0l1, d2qr0l2
  • Chain 'M':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0m1, d2qr0m2
  • Chain 'N':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0n1, d2qr0n2
  • Chain 'O':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0o1
  • Chain 'P':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0p1
  • Chain 'Q':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0q1, d2qr0q2
  • Chain 'R':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0r1, d2qr0r2
  • Chain 'S':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0s1, d2qr0s2
  • Chain 'T':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0t1, d2qr0t2
  • Chain 'U':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0u1
  • Chain 'V':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2qr0v1
  • Chain 'W':
    Compound: Fab-Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-212)
    Domains in SCOPe 2.03: d2qr0w1, d2qr0w2
  • Chain 'X':
    Compound: Fab-Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QR0 (0-220)
    Domains in SCOPe 2.03: d2qr0x1, d2qr0x2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0A (A:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qr0B (B:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0B (B:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qr0C (C:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0C (C:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0D (D:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0E (E:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qr0F (F:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0F (F:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0G (G:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qr0H (H:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0H (H:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2qr0I (I:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0I (I:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0J (J:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0K (K:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2qr0L (L:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0L (L:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0M (M:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2qr0N (N:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0N (N:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2qr0O (O:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0O (O:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0P (P:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0Q (Q:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2qr0R (R:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0R (R:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0S (S:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2qr0T (T:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0T (T:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2qr0U (U:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0U (U:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0V (V:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qr0W (W:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2qr0X (X:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr0X (X:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsy
    adsvkgrftisadtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtvssas
    tkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepksc