PDB entry 2qqk

View 2qqk on RCSB PDB site
Description: Neuropilin-2 a1a2b1b2 Domains in Complex with a Semaphorin-Blocking Fab
Class: signaling protein
Keywords: VEGF receptor, semaphorin receptor, Phage-Derived Antibody, Developmental protein, Differentiation, Glycoprotein, Membrane, Neurogenesis, Transmembrane, HORMONE, SIGNALING PROTEIN
Deposited on 2007-07-26, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuropilin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NRP2, VEGF165R2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QQK (0-230)
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QQK (0-End)
    Domains in SCOPe 2.07: d2qqkl1, d2qqkl2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2qqkL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqawaylptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qqkL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqawaylptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr