PDB entry 2qqa

View 2qqa on RCSB PDB site
Description: Crystal Structure of DtxR(E9A C102D) Complexed with Nickel(II)
Class: transcription regulator
Keywords: REPRESSOR, REGULATOR, DTXR, HELIX-TURN-HELIX, METAL ION, ACTIVATION, DNA-BINDING, FERROUS IRON, Cytoplasm, Transcription, Transcription regulation, transcription regulator
Deposited on 2007-07-26, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (Start-225)
      • engineered (8)
      • engineered (101)
      • variant (146)
      • variant (213)
    Domains in SCOPe 2.07: d2qqaa1, d2qqaa2, d2qqaa3
  • Heterogens: NI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qqaA (A:)
    mkdlvdttamylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qqaA (A:)
    dlvdttamylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelgvapgtrvidaatsmprkvrivqineifqvetdqftqlldadir
    vgseveivdrdghitlshngkdvellddlahtirieel