PDB entry 2qq5

View 2qq5 on RCSB PDB site
Description: Crystal structure of human SDR family member 1
Class: oxidoreductase
Keywords: DHRS1, SDR, DEHYDROGENASE, REDUCTASE, SHORT-CHAIN, STRUCTURAL GENOMICS CONSORTIUM, SGC, Oxidoreductase
Deposited on 2007-07-26, released 2007-08-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydrogenase/reductase SDR family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DHRS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qq5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qq5A (A:)
    apmngqvcvvtgasrgigrgialqlckagatvyitgrhldtlrvvaqeaqslggqcvpvv
    cdssqesevrslfeqvdreqqgrldvlvnnayagvqtilntrnkafwetpasmwddinnv
    glrghyfcsvygarlmvpagqglivvisspgslqymfnvpygvgkaacdklaadcahelr
    rhgvscvslwpgivqtellkehmakeevlqdpvlkqfksafssaettelsgkcvvalatd
    pnilslsgkvlpscdlarry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qq5A (A:)
    apmngqvcvvtgasrgigrgialqlckagatvyitgrhldtlrvvaqeaqslggqcvpvv
    cdssqesevrslfeqvdreqqgrldvlvnnayagvqtilntrnkafwetpasmwddinnv
    glrghyfcsvygarlmvpagqglivvisspgslqymfnvpygvgkaacdklaadcahelr
    rhgvscvslwpgivqtellssaettelsgkcvvalatdpnilslsgkvlpscdlarry