PDB entry 2qpu

View 2qpu on RCSB PDB site
Description: Sugar tongs mutant S378P in complex with acarbose
Class: hydrolase
Keywords: ALPHA BETA 8 BARREL, SUGAR TONGS MUTANT COMPLEX, Carbohydrate metabolism, Germination, Glycosidase, Hydrolase, Metal-binding, Secreted
Deposited on 2007-07-25, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • engineered (283)
      • engineered (377)
    Domains in SCOPe 2.08: d2qpua1, d2qpua2
  • Chain 'B':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • engineered (283)
      • engineered (377)
    Domains in SCOPe 2.08: d2qpub1, d2qpub2
  • Chain 'C':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • engineered (283)
      • engineered (377)
    Domains in SCOPe 2.08: d2qpuc1, d2qpuc2
  • Heterogens: CA, EDO, QPU, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qpuA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpuA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qpuB (B:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpuB (B:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qpuC (C:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpuC (C:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek