PDB entry 2qps

View 2qps on RCSB PDB site
Description: "Sugar tongs" mutant Y380A in complex with acarbose
Class: hydrolase
Keywords: BETA ALPHA 8 BARREL, SUGAR TONGS COMPLEX, Carbohydrate metabolism, Germination, Glycosidase, Hydrolase, Metal-binding, Secreted
Deposited on 2007-07-25, released 2008-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • engineered (283)
      • engineered (379)
    Domains in SCOPe 2.06: d2qpsa1, d2qpsa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qpsA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpsA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwek