PDB entry 2qpf

View 2qpf on RCSB PDB site
Description: Crystal Structure of Mouse Transthyretin
Class: transport protein
Keywords: Transport protein, amyloidogenesis, tetramer, Glycoprotein, Hormone, Retinol-binding, Secreted, Thyroid hormone, Vitamin A
Deposited on 2007-07-23, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfd_
  • Chain 'E':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfe_
  • Chain 'F':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpff_
  • Chain 'G':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfg_
  • Chain 'H':
    Compound: Transthyretin
    Species: Mus musculus [TaxId:10090]
    Gene: TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qpfh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qpfA (A:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfA (A:)
    skcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfveg
    vyrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qpfB (B:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfB (B:)
    kcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegv
    yrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qpfC (C:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfC (C:)
    skcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfveg
    vyrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qpfD (D:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfD (D:)
    cplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegvy
    rveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qpfE (E:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfE (E:)
    kcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegv
    yrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvsn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qpfF (F:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfF (F:)
    kcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegv
    yrveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvsn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2qpfG (G:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfG (G:)
    cplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegvy
    rveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2qpfH (H:)
    mgpagageskcplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglt
    tdekfvegvyrveldtksywktlgispfhefadvvftandsghrhytiaallspysystt
    avvsnpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpfH (H:)
    cplmvkvldavrgspavdvavkvfkktsegswepfasgktaesgelhglttdekfvegvy
    rveldtksywktlgispfhefadvvftandsghrhytiaallspysysttavvs