PDB entry 2qp8

View 2qp8 on RCSB PDB site
Description: Structure of BACE Bound to SCH734723
Class: hydrolase
Keywords: BACE1, protease, Alternative splicing, Aspartyl protease, Glycoprotein, Hydrolase, Membrane, Transmembrane, Zymogen
Deposited on 2007-07-23, released 2008-03-11
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-11, with a file datestamp of 2008-03-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: HOMO SAPIENS
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qp8a1
  • Chain 'B':
    Compound: Beta-secretase 1
    Species: HOMO SAPIENS
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qp8b1
  • Heterogens: SC7, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qp8A (A:)
    aagrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qp8A (A:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
    ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
    pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
    ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
    sachvhdefrtaavegpfvtldmedcgyni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qp8B (B:)
    aagrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qp8B (B:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
    ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
    pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
    ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
    sachvhdefrtaavegpfvtldmedcgyn