PDB entry 2qp3

View 2qp3 on RCSB PDB site
Description: Identification and Characterization of Two Amino Acids Critical for the Substrate Inhibition of SULT2A1
Class: transferase
Keywords: Dehydroepiandrosterone(DHEA), androsterone(ADT), substrate inhibition, sulfotransferase, substrate binding orientation, Bile acid catabolism, Lipid metabolism, Steroid metabolism, Transferase
Deposited on 2007-07-23, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06520 (0-283)
      • engineered (135)
      • conflict (241)
    Domains in SCOPe 2.07: d2qp3a_
  • Heterogens: AOX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qp3A (A:)
    sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
    dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
    nprdvlvsgyffwknikfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
    lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
    ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qp3A (A:)
    sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
    dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
    nprdvlvsgyffwknikfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
    lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkeyvvdktqlsgdwknhf
    tvaqaedfdklfqekmadlprelfpwe