PDB entry 2qoj

View 2qoj on RCSB PDB site
Description: Coevolution of a homing endonuclease and its host target sequence
Class: hydrolase/DNA
Keywords: LAGLIDADG homing endonuclease, I-AniI, Hydrolase, Intron homing, Mitochondrion, mRNA processing, mRNA splicing, hydrolase/DNA COMPLEX
Deposited on 2007-07-20, released 2008-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: I-AniI DNA target seq1
  • Chain 'Y':
    Compound: I-AniI DNA target seq2
  • Chain 'Z':
    Compound: Intron-encoded DNA endonuclease I-AniI
    Species: Emericella nidulans
    Gene: I-AniI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03880 (2-253)
      • expression tag (0-1)
      • engineered (60)
    Domains in SCOPe 2.05: d2qojz1, d2qojz2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qojZ (Z:)
    gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk
    rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr
    sdeplnsiesiintsyfsawlvgfieaegcfsvyklnkdddyliasfdiaqrdgdilisa
    irkylsfttkvyldktncsklkvtsvrsveniikflqnapvkllgnkklqyllwlkqlrk
    isrysekikipsny