PDB entry 2qoh

View 2qoh on RCSB PDB site
Description: Crystal Structure of Abl kinase bound with PPY-A
Class: transferase
Keywords: Abl, kinase, inhibitor, TRANSFERASE
Deposited on 2007-07-20, released 2007-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d2qoha_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d2qohb_
  • Heterogens: P3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qohA (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qohA (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkeeveeflkeaavm
    keikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissa
    meylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapes
    laynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvye
    lmracwqwnpsdrpsfaeihqafetmfqess
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qohB (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qohB (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkmeveeflkeaavm
    keikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissa
    meylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapes
    laynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvye
    lmracwqwnpsdrpsfaeihqafetmfqessisdevekelg