PDB entry 2qnx

View 2qnx on RCSB PDB site
Description: Crystal structure of the complex between the mycobacterium beta-ketoacyl-acyl carrier protein synthase III (FABH) and 11-[(decyloxycarbonyl)dithio]-undecanoic acid
Class: transferase
Keywords: FATTY ACID BIOSYNTHESIS, MYOBACTERIUM TUBERCULOSIS, STRUCTURAL BASIS FOR SUBSTRATE SPECIFICITY, ENZYME INHIBITOR COMPLEX, MECHANISM BASED INHIBITOR, Acyltransferase, Lipid synthesis, Multifunctional enzyme, Transferase
Deposited on 2007-07-19, released 2008-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qnxa1, d2qnxa2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qnxb1, d2qnxb2
  • Heterogens: UDT, MDX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qnxA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qnxA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qnxB (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qnxB (B:)
    mteiattsgarsvgllsvgayrpervvtndeicidssdewiytrtgiktrrfaaddesaa
    smateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagc
    agfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfq
    gigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrram
    daagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamael
    lttgaakpgdlalligygaglsyaaqvvrmpk