PDB entry 2qnw

View 2qnw on RCSB PDB site
Description: Toxoplasma gondii apicoplast-targeted acyl carrier protein
Class: signaling protein
Keywords: malaria, acyl carrier protein, SGC, Structural Genomics Consortium, Fatty acid biosynthesis, Lipid synthesis, Phosphopantetheine, Transit peptide, TRANSPORT PROTEIN, SIGNALING PROTEIN
Deposited on 2007-07-19, released 2007-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qnwa_
  • Heterogens: ZN, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qnwA (A:)
    gssddrpllervkdvvadqlgvdrarinpesnfikdldadsldsvelvmafeekfgvsip
    deeaskiatvqdalsyiekaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qnwA (A:)
    sddrpllervkdvvadqlgvdrarinpesnfikdldadsldsvelvmafeekfgvsipde
    easkiatvqdalsyiekaks