PDB entry 2qnv

View 2qnv on RCSB PDB site
Description: Crystal Structure of the Pregnane X Receptor bound to Colupulone
Class: nuclear protein
Keywords: Alpha Helical Sandwhich, Protein-Ligand complex, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, NUCLEAR PROTEIN
Deposited on 2007-07-19, released 2008-07-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor pxr
    Species: HOMO SAPIENS
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qnva1
  • Heterogens: CDZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qnvA (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qnvA (A:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvlkvslqlrgedgsvwnykppafsl
    lphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtw
    ecgrlsycleqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdql
    qeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplm
    qelfgitgs