PDB entry 2qno

View 2qno on RCSB PDB site
Description: Crystal Structure of the Mutant E55Q of the Cellulase CEL48F in Complex with a Thio-Oligosaccharide
Class: Hydrolase
Keywords: Cellulase, Thio-oligosaccharide complex, Inactive mutant, GH family 48, alpha-alpha-six barrel, Carbohydrate metabolism, Cellulose degradation, Glycosidase, Hydrolase, Polysaccharide degradation
Deposited on 2007-07-19, released 2008-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.14
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase F
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: celCCF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37698 (0-628)
      • engineered (54)
    Domains in SCOPe 2.06: d2qnoa_
  • Heterogens: SGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qnoA (A:)
    asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttsqamsyy
    mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
    ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
    qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
    wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
    awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
    qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
    rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
    nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
    veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
    qvptqrlhrfwaqsefavangvyailfpd