PDB entry 2qn8

View 2qn8 on RCSB PDB site
Description: Glycogen Phosphorylase b in complex with N-4-nitrobenzoyl-N'-beta-D-glucopyranosyl urea
Class: transferase
Keywords: glycogenolysis, type 2 diabetes, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2007-07-18, released 2008-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • see remark 999 (379)
    Domains in SCOPe 2.07: d2qn8a_
  • Heterogens: SO4, PLP, NBY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qn8A (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn8A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    vggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnfd
    afpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerw
    pvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlcia
    gshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaeri
    geeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqv
    kriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaig
    dvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngal
    tigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlss
    gffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniat
    sgkfssdrtiaqyareiwgvepsrqrlpa