PDB entry 2qn6

View 2qn6 on RCSB PDB site
Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
Class: translation
Keywords: initiation of translation, GTP-binding, Initiation factor, Nucleotide-binding, Protein biosynthesis, RNA-binding
Deposited on 2007-07-18, released 2007-11-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-11, with a file datestamp of 2007-12-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: SULFOLOBUS SOLFATARICUS
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qn6a1, d2qn6a2, d2qn6a3
  • Chain 'B':
    Compound: Translation initiation factor 2 alpha subunit
    Species: SULFOLOBUS SOLFATARICUS
    Gene: eif2a
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qn6b1
  • Chain 'C':
    Compound: Translation initiation factor 2 beta subunit
    Species: SULFOLOBUS SOLFATARICUS
    Gene: eif2b
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qn6A (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn6A (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtlgyaetnigvcesckkpeayvtepsck
    scgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtrehfva
    lgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinidsli
    egieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikv
    lpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsi
    itladaevpvlwnirikynllervvvdpiraketlmlsvgssttlgivtsvkkdeievel
    rrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qn6B (B:)
    mrkvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvg
    tnpkeasealnqiisnlikigkeenvdisvvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn6B (B:)
    kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
    pkeasealnqiisnlikigkeenvdisvvk
    

  • Chain 'C':
    No sequence available.