PDB entry 2qn5

View 2qn5 on RCSB PDB site
Description: Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin
Class: Hydrolase inhibitor/Hydrolase
Keywords: RBTI, Bowman-Birk Inhibitor, monocotyledonous plant, reactive-site loop, protease-inhibitor, plant-pest systems, Protease inhibitor, Serine protease inhibitor, Calcium, Digestion, Hydrolase, Metal-binding, Secreted, Zymogen, Hydrolase inhibitor/Hydrolase COMPLEX, HETERO-DIMER
Deposited on 2007-07-18, released 2008-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.256
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Bowman-Birk type bran trypsin inhibitor
    Species: Oryza sativa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qn5b1, d2qn5b2
  • Chain 'T':
    Compound: cationic trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qn5t_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qn5B (B:)
    merpwkccdnikrlptkpdppqwrcndelepsqctaackscreapgpfpgklicediywg
    adpgpfctprpwgdccdkafcnkmnpptcrcmdevkecadackdcqrvesseppryvckd
    rftghpgpvckpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn5B (B:)
    merpwkccdnikrlptkpdppqwrcndelepsqcckscricediywgadpgpfctprpwg
    dccdkafcnkmnpptcrcvkecadackdcqrvesseckdrftghpgpvck
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qn5T (T:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn