PDB entry 2qn2

View 2qn2 on RCSB PDB site
Description: Glycogen Phosphorylase b in complex with Maslinic Acid
Class: transferase, apoptosis
Keywords: glycogenolysis, type 2 diabetes, TRANSFERASE, APOPTOSIS
Deposited on 2007-07-17, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.17
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qn2a_
  • Heterogens: 0MA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qn2A (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn2A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksskfg
    tnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlpa