PDB entry 2qmz

View 2qmz on RCSB PDB site
Description: Quinone Reductase 2 in Complex with Dopamine
Class: oxidoreductase
Keywords: Quinone Reductase 2, dopamine, dopamine oxidation, Parkinson's Disease, Cytoplasm, FAD, Flavoprotein, Metal-binding, Oxidoreductase, Polymorphism, Zinc
Deposited on 2007-07-17, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosyldihydronicotinamide dehydrogenase
    Species: HOMO SAPIENS
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qmza_
  • Chain 'B':
    Compound: Ribosyldihydronicotinamide dehydrogenase
    Species: HOMO SAPIENS
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qmzb_
  • Heterogens: ZN, FAD, LDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qmzA (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qmzB (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq