PDB entry 2qmp

View 2qmp on RCSB PDB site
Description: Crystal Structure of HIV-1 protease complexed with PL-100
Class: hydrolase
Keywords: HIV-1 protease, Aspartyl protease, Hydrolase, Multifunctional enzyme, Nucleotidyltransferase, RNA-directed DNA polymerase, Transferase
Deposited on 2007-07-16, released 2008-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WFL7 (0-98)
  Domains in SCOPe 2.04: d2qmpa_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WFL7 (0-98)
  Domains in SCOPe 2.04: d2qmpb_
• Heterogens: A00, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qmpA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qmpB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf