PDB entry 2qmj

View 2qmj on RCSB PDB site
Description: Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose
Class: hydrolase
Keywords: Hydrolase, Glycosyl Hydrolase Family 31, Glycoprotein, Glycosidase, Membrane, Multifunctional enzyme, Signal-anchor, Sulfation, Transmembrane
Deposited on 2007-07-16, released 2008-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltase-glucoamylase, intestinal
    Species: Homo sapiens [TaxId:9606]
    Gene: MGAM, MGA, MGAML
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43451 (Start-867)
      • expression tag (868-869)
    Domains in SCOPe 2.07: d2qmja1, d2qmja2, d2qmja3, d2qmja4, d2qmja5
  • Heterogens: ACR, NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qmjA (A:)
    saecpvvnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvn
    tnagftarlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfs
    gnaaasltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvygl
    gehvhqqyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsna
    mevvlqpapaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsrye
    ygtldnmrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqk
    lviivdpaisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpnc
    avwwtkefelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfck
    tlcmdavqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwl
    gdntatwddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnh
    ngqgykdqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefy
    ednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemel
    pgdkiglhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtva
    nkvyllcefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsp
    tvtydsnlkvaiitdidlllgeaytvewah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qmjA (A:)
    vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
    arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
    ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
    qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
    papaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsryeygtldn
    mrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqklviivd
    paisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpncavwwtk
    efelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfcktlcmda
    vqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwlgdntat
    wddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnhngqgyk
    dqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefyednstw
    dvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemelpgdkig
    lhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyll
    cefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsn
    lkvaiitdidlllgeaytvewah