PDB entry 2qmd

View 2qmd on RCSB PDB site
Description: Structure of BACE Bound to SCH722924
Class: hydrolase
Keywords: BACE1, protease, Alternative splicing, Aspartyl protease, Glycoprotein, Hydrolase, Membrane, Transmembrane, Zymogen
Deposited on 2007-07-16, released 2008-03-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.187
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qmda_
  • Chain 'B':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qmdb_
  • Heterogens: TAR, CS7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qmdA (A:)
    aagrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qmdA (A:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
    ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
    pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
    ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
    sachvhdefrtaavegpfvtldmedcgyni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qmdB (B:)
    aagrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qmdB (B:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
    ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
    pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
    ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
    sachvhdefrtaavegpfvtldmedcgyn