PDB entry 2qlx
View 2qlx on RCSB PDB site
Description: Crystal structure of rhamnose mutarotase RhaU of Rhizobium leguminosarum in complex with L-Rhamnose
Class: isomerase
Keywords: RhaU, mutarotase, Rhizobium leguminosarum. L-rhamnose, Carbohydrate metabolism, Isomerase, Rhamnose metabolism
Deposited on
2007-07-13, released
2008-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: L-rhamnose mutarotase
Species: Rhizobium leguminosarum bv. trifolii [TaxId:386]
Gene: rhaM, rhaU
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2qlxa1, d2qlxa2 - Chain 'B':
Compound: L-rhamnose mutarotase
Species: Rhizobium leguminosarum bv. trifolii [TaxId:386]
Gene: rhaM, rhaU
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2qlxb1, d2qlxb2 - Heterogens: RM4, MG, FMT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2qlxA (A:)
gdmtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvl
trpkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2qlxB (B:)
gdmtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvl
trpkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp