PDB entry 2qls

View 2qls on RCSB PDB site
Description: crystal structure of hemoglobin from dog (Canis familiaris) at 3.5 Angstrom resolution
Class: transport protein
Keywords: Erythrocyte, Transport, Oxygen transport, Heme, TRANSPORT PROTEIN
Deposited on 2007-07-13, released 2008-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.203
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Canis familiaris
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Canis familiaris
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qlsb1
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Canis familiaris
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Canis familiaris
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qlsd1
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlsB (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlsD (D:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh