PDB entry 2qlr

View 2qlr on RCSB PDB site
Description: Crystal structure of human kynurenine aminotransferase II
Class: transferase
Keywords: ALPHA & BETA PROTEIN, PLP-DEPENDENT TRANSFERASE, Aminotransferase, Mitochondrion, Multifunctional enzyme, Pyridoxal phosphate, Transit peptide, TRANSFERASE
Deposited on 2007-07-13, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlra_
  • Chain 'B':
    Compound: Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlrb_
  • Chain 'C':
    Compound: Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlrc_
  • Chain 'D':
    Compound: Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AADAT, KAT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlrd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlrA (A:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlrB (B:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlrC (C:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlrD (D:)
    mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl