PDB entry 2qlp

View 2qlp on RCSB PDB site
Description: Bifunctional dCTP deaminase:dUTPase from Mycobacterium tuberculosis, apo form
Class: hydrolase
Keywords: distorted beta barrel, Hydrolase, Nucleotide metabolism
Deposited on 2007-07-13, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpa_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpb_
  • Chain 'C':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpc_
  • Chain 'D':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpd_
  • Chain 'E':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpe_
  • Chain 'F':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qlpf_
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qlpA (A:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qlpB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlpB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qlpC (C:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlpC (C:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qlpD (D:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlpD (D:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspseh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qlpE (E:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlpE (E:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qlpF (F:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlpF (F:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltsps