PDB entry 2qll

View 2qll on RCSB PDB site
Description: Human liver glycogen phosphorylase- GL complex
Class: transferase
Keywords: drug discovery, glycogen metabolism, protein-protein interaction, Allosteric enzyme, Carbohydrate metabolism, Disease mutation, Glycogen storage disease, Glycosyltransferase, Nucleotide-binding, Phosphorylation, Pyridoxal phosphate, Transferase
Deposited on 2007-07-13, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • modified residue (14)
    Domains in SCOPe 2.07: d2qlla_
  • Chain 'B':
    Compound: protein targeting to glycogen - GL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2QLL (0-3)
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qllA (A:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qllA (A:)
    ltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhl
    vgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldieele
    eieedaglgngglgrlaacfldsmatlglaaygygiryfnqkirdgwqveeaddwlrygn
    pweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsar
    apnvldrnlaenisrvlypfegkelrlkqeyfvvaatlqdiirrfkaskfgtvfdafpdq
    vaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlv
    ekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshav
    ngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyv
    kdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkrihe
    ykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnn
    dpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtm
    dganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffsp
    kqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfs
    sdrtikeyaqniwnvepsdlkislsn
    

  • Chain 'B':
    No sequence available.