PDB entry 2ql0

View 2ql0 on RCSB PDB site
Description: Zinc-substituted Rubredoxin from Desulfovibrio Vulgaris
Class: electron transport
Keywords: [Fe-4S], Electron Transport, Iron, Metal-binding
Deposited on 2007-07-12, released 2008-07-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris
    Gene: rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ql0a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ql0A (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa