PDB entry 2qkx

View 2qkx on RCSB PDB site
Description: N-acetyl glucosamine 1-phosphate uridyltransferase from Mycobacterium tuberculosis complex with N-acetyl glucosamine 1-phosphate
Class: transferase
Keywords: rossmann, beta-helix, substrate complex, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2007-07-11, released 2008-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene: glmU, Rv1018c, MT1046
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qkxa1, d2qkxa2
  • Heterogens: GN1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qkxA (A:)
    gsmtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlgh
    dhqriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpll
    dadtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreir
    evnagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagv
    nnrvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqi
    ggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgaf
    vevknstigtgtkvphltyvgdadigeysni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qkxA (A:)
    tfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhq
    riaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldad
    tladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevn
    agvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnr
    vqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggr
    cvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvev
    knstigtgtkvphltyvgdadigeysni