PDB entry 2qkw

View 2qkw on RCSB PDB site
Description: Structural basis for activation of plant immunity by bacterial effector protein AvrPto
Class: transferase
Keywords: three-helix bundle motif, Avrpto-pto duplex, layered beta-sheets, Kinase, Serine/threonine-protein kinase, TRANSFERASE
Deposited on 2007-07-11, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.274
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avirulence protein
    Species: Pseudomonas syringae [TaxId:317]
    Gene: avrP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qkwa1
  • Chain 'B':
    Compound: Protein kinase
    Species: Solanum pimpinellifolium [TaxId:4084]
    Gene: Pto
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qkwA (A:)
    mgnicvggsrmahqvnspdrvsnnsgdednvtssqllsvrhqlaesaglprdqhefvssq
    apqslrnrynnlyshtqrtldmadmqhrymtgasginpgmlphenvddmrsaitdwsdmr
    ealqhamgihadippsperfvatmnpsgsirmstlspspyrnwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qkwA (A:)
    dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr
    ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgi
    

  • Chain 'B':
    No sequence available.