PDB entry 2qkr

View 2qkr on RCSB PDB site
Description: Cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with indirubin 3'-monoxime bound
Class: transferase
Keywords: Cp-specific cyclin-dependent kinase, malaria, cryptosporidium parvum, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2007-07-11, released 2007-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cdc2-like CDK2/CDC28 like protein kinase
    Species: Cryptosporidium parvum Iowa II [TaxId:353152]
    Gene: cgd5_2510
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CRJ8 (18-End)
      • expression tag (14-17)
    Domains in SCOPe 2.06: d2qkra1, d2qkra2
  • Heterogens: IXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qkrA (A:)
    mhhhhhhssgrenlyfqglmekyqklekvgegtygvvykakdsqgrivalkrirldaede
    gipstaireisllkelhhpnivslidvihsercltlvfefmekdlkkvldenktglqdsq
    ikiylyqllrgvahchqhrilhrdlkpqnllinsdgalkladfglarafgipvrsythev
    vtlwyrapdvlmgskkystsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpn
    prewpqvqelplwkqrtfqvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamn
    hpyfkdldpqimi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qkrA (A:)
    yfqglmekylekvgegvvykakdsqrivalkristaireisllkelhhpnivslidvihs
    ecltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhrilhrdlkpqnll
    insdalkladfglarafgipvrvvtlwyrapdvlmgskkystsvdiwsigcifaemitgk
    plfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfekkpwssiipgfcqeg
    idllsnmlcfdpnkrisardamnhpyfkdldpq