PDB entry 2qkf

View 2qkf on RCSB PDB site
Description: Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
Class: transferase
Keywords: MANNO-OCTULOSONATE, SYNTHASE, LIPOPOLYSACCHARIDE, KDOP, KDO8 KDOPS, KDO8PS, TIM barrel, Lipopolysaccharide biosynthesis, Transferase, LYASE
Deposited on 2007-07-11, released 2008-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
  Species: Neisseria meningitidis serogroup B
  Gene: kdsA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZ55 (0-End)
• Chain 'B':
  Compound: 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
  Species: Neisseria meningitidis serogroup B
  Gene: kdsA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZ55 (0-End)
• Chain 'C':
  Compound: 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
  Species: Neisseria meningitidis serogroup B
  Gene: kdsA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZ55 (0-End)
• Chain 'D':
  Compound: 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
  Species: Neisseria meningitidis serogroup B
  Gene: kdsA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZ55 (0-End)
  Domains in SCOPe 2.01: d2qkfd_
• Heterogens: CL, NA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2qkfD (D:)
  mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
  ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
  lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
  fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd
  pklakcdgpsalplhlledflirikalddliksqpiltie
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2qkfD (D:)
  mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
  ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
  lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
  fgvmkqtcgnlpvifdvthslqtaqaldlalagmatrlaglfleshalplhlledfliri
  kalddliksqpil