PDB entry 2qkc

View 2qkc on RCSB PDB site
Description: Structural and Kinetic Study of the Differences between Human and E.coli Manganese Superoxide Dismutases
Class: oxidoreductase
Keywords: metalloenzyme, proton wire, Acetylation, Manganese, Metal-binding, Mitochondrion, Oxidoreductase, Polymorphism, Transit peptide
Deposited on 2007-07-10, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-195)
      • engineered (65)
    Domains in SCOPe 2.07: d2qkca1, d2qkca2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-195)
      • engineered (65)
    Domains in SCOPe 2.07: d2qkcc1, d2qkcc2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qkcA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalklnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qkcC (C:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalklnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymac