PDB entry 2qk4

View 2qk4 on RCSB PDB site
Description: Human glycinamide ribonucleotide synthetase
Class: ligase
Keywords: PURINE SYNTHESIS, ENZYME, PROTEIN-ATP COMPLEX, Structural Genomics, Structural Genomics Consortium, SGC, LIGASE
Deposited on 2007-07-10, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.174
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trifunctional purine biosynthetic protein adenosine-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GART, PGFT, PRGS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (22-End)
      • cloning artifact (21)
      • variant (442)
    Domains in SCOPe 2.07: d2qk4a1, d2qk4a2, d2qk4a3, d2qk4a4
  • Chain 'B':
    Compound: Trifunctional purine biosynthetic protein adenosine-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GART, PGFT, PRGS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (22-451)
      • cloning artifact (21)
      • variant (442)
    Domains in SCOPe 2.07: d2qk4b1, d2qk4b2, d2qk4b3, d2qk4b4
  • Heterogens: CL, SO4, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qk4A (A:)
    mhhhhhhssgvdlgtenlyfqsmaarvliigsggrehtlawklaqshhvkqvlvapgnag
    tacsekisntaisisdhtalaqfckekkiefvvvgpeaplaagivgnlrsagvqcfgpta
    eaaqlesskrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglaagkgv
    ivakskeeackavqeimqekafgaagetivieelldgeevsclcftdgktvapmppaqdh
    krllegdggpntggmgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagim
    ltkngpkvlefncrfgdpecqvilpllksdlyeviqstldgllctslpvwlenhtaltvv
    maskgypgdytkgveitgfpeaqalglevfhagtalkngkvvthggrvlavtairenlis
    aleeakkglaaikfegaiyrkdigfraiaflq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qk4A (A:)
    smaarvliigsggrehtlawklaqshhvkqvlvapgnagtacsekisntaisisdhtala
    qfckekkiefvvvgpeaplaagivgnlrsagvqcfgptaeaaqlesskrfakefmdrhgi
    ptaqwkaftkpeeacsfilsadfpalvvkasglkgvivakskeeackavqeimqeetivi
    eelldgeevsclcftdgktvapmppaqdhkrllegdggpntggmgaycpapqvsndlllk
    ikdtvlqrtvdgmqqegtpytgilyagimltkngpkvlefncrfgdpecqvilpllksdl
    yeviqstldgllctslpvwlenhtaltvvmaskgypgdytkgveitgfpeaqalglevfh
    agtalkngkvvthggrvlavtairenlisaleeakkglaaikfegaiyrkdigfraiafl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qk4B (B:)
    mhhhhhhssgvdlgtenlyfqsmaarvliigsggrehtlawklaqshhvkqvlvapgnag
    tacsekisntaisisdhtalaqfckekkiefvvvgpeaplaagivgnlrsagvqcfgpta
    eaaqlesskrfakefmdrhgiptaqwkaftkpeeacsfilsadfpalvvkasglaagkgv
    ivakskeeackavqeimqekafgaagetivieelldgeevsclcftdgktvapmppaqdh
    krllegdggpntggmgaycpapqvsndlllkikdtvlqrtvdgmqqegtpytgilyagim
    ltkngpkvlefncrfgdpecqvilpllksdlyeviqstldgllctslpvwlenhtaltvv
    maskgypgdytkgveitgfpeaqalglevfhagtalkngkvvthggrvlavtairenlis
    aleeakkglaaikfegaiyrkdigfraiaflq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qk4B (B:)
    smaarvliigsggrehtlawklaqshhvkqvlvapgnagtacsekisntaisisdhtala
    qfckekkiefvvvgpeaplaagivgnlrsagvqcfgptaeaaqlesskrfakefmdrhgi
    ptaqwkaftkpeeacsfilsadfpalvvkasglagvivakskeeackavqeimqekaget
    ivieelldgeevsclcftdgktvapmppaqdhkrllegdggpntggmgaycpapqvsndl
    llkikdtvlqrtvdgmqqegtpytgilyagimltkngpkvlefncrfgdpecqvilpllk
    sdlyeviqstldgllctslpvwlenhtaltvvmaskgypgdytkgveitgfpeaqalgle
    vfhagtalkngkvvthggrvlavtairenlisaleeakkglaaikfegaiyrkdigfrai
    aflq