PDB entry 2qjz

View 2qjz on RCSB PDB site
Description: Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
Class: protein binding
Keywords: EB1, calponin homology domain, microtubule plus end, +TIP, PROTEIN BINDING
Deposited on 2007-07-09, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15691 (Start-122)
      • modified residue (9)
      • modified residue (37)
      • modified residue (39)
      • modified residue (74)
    Domains in SCOPe 2.07: d2qjza_
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15691 (Start-122)
      • modified residue (9)
      • modified residue (37)
      • modified residue (39)
      • modified residue (74)
    Domains in SCOPe 2.07: d2qjzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qjzA (A:)
    gsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqaklehe
    yiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaar
    qgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjzA (A:)
    dnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyi
    qnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaarqg
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qjzB (B:)
    gsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqaklehe
    yiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaar
    qgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjzB (B:)
    lsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyiqn
    fkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaarqgq